Teambuilding Exercises Tailored to Unique Business Challenges. Teambuilding exercises often get a bad rap as a waste of employees' time, but some entrepreneurs are finding value in activities that are tailored to resolve specific challenges in their business. Designed correctly, teambuilding programs can strengthen unraveling employee relationships, help sustain corporate culture during periods of fast growth, and build morale amid layoffs, human- resource experts say. "People have a negative association with teambuilding - - they want to roll their eyes," says Stella Grizont, founder of Woopaah, a New York firm that develops creative activities to help companies solve HR problems. But when we're playing, we're automatically in a (more open) state, and you see a different side of a person that you don't see at your job."Here are three entrepreneurs who used innovative and entertaining teambuilding exercises to solve their workplace dilemmas: Michelle Madhok, founder of She. Finds Media. Photo courtesy of the company. ![]() She. Finds Media, publisher of She. Finds. com and Mom. Finds. com. Challenge: Despite having only 1. She. Finds Media, creator of New York- based shopping sites, needed to resolve misunderstandings between departments. We have an editorial staff and our marketing and sales staff- -[the editorial] group is very introverted and the other is extroverted," explains Michelle Madhok, who started the company in 2. There's a conflict over personality style."Exercise: The staff tried several games to improve relations between the two departments. First, they did a blind taste test of different foods to create trust. Then, they confronted their fears by smashing clay pots on which they had written about what was holding them back both at work and in their personal life. Finally, workers changed into white jumpsuits and threw paint on one another. It made people more emotional and vulnerable," Madhok says. When people know each other personally they can be more sympathetic to the plight of others when there's a problem at work." The half- day exercise helped employees bond and gain a better understanding of one another's roles at the company, she says. Expert advice: "When people have a shared experience of a challenge with some intensity, on a biochemical level they are releasing a certain hormone that makes them feel connected," says Grizont, who set up the creative exercises for She. Finds. "We create experiences to really help them be vulnerable in a safe space…You see a different side of a person that you don't see at your job."Related: How to Create Your Own Dream Team in Business. Jim Koch, founder of Boston Beer Co., maker of Sam Adams beer. Photo courtesy of the company. ![]() Boston Beer Co. Challenge: When Jim Koch started brewing Sam Adams beer, he wanted employees to feel as passionately as he did about craft brewing and to reflect it in their interactions with customers. Many thought beer is differentiated by brand but that it all tasted the same," Koch says. Exercise: To educate employees in an entertaining way, as well as bring them together as a team, Koch came up with Beer Jeopardy, an annual game where roughly half of the 8. IQ. All departments compete, but employees in the brewery play a tougher version of the quiz game separately. In addition to answering trivia questions, employees must do blind taste tests to identify different brews. Top prizes include hop- buying trips abroad and a visit to Oktoberfest in Munich. Team bonding Singapore: the leading provider for training, facilitation and team building, offering diverse innovative solutions for groups 5 to 1,500 pax. Team Building Activities in London. Whether you are looking for a fun team building challenge for an away day or an engaging element for a conference, we offer a. Fun Team Building Activities for Adults for your next team building event. · 3 Teambuilding Exercises Tailored to Unique Business Challenges. finding value in activities that are tailored to resolve. together as a team. TeamBonding offers many different outdoor team building programs that will get your team having fun and working together outside. Outdoor Activities. · Team-building exercises really divide opinion, people love team or loathe them. Mind Tools readers share their experiences of some effective activities. The game "has a way of knitting us together," Koch says. Boston Beer founder Jim Koch at the podium hosting Beer Jeopardy, a company event that tests employees beer IQ. Energizing corporate team building activities, events and ice breakers for large groups, custom tailored to accommodate your team's specific goals. · Survey Reveals 25 Unusual Team-Building Activities. "What is the wackiest or most unusual team-building activity you've ever participated in or heard. Photo courtesy of the company. Expert advice: A creative approach works well when trying to teach company and industry knowledge, says Aneil Mishra, managing partner at Total Trust Coaching and Consulting, a Durham, N. C., firm that provides team development programs. Games and creative exercises such as this are more likely to be retained by employees than rote memorization."Related: How to Become a Better Leader. Joss and Main, a home décor private sales website John Mulliken, founder of Joss and Main. Photo courtesy of the company. Challenge: After John Mulliken launched home décor website, Joss and Main, the staff grew from 3 to 7. Employees who once interacted with the entire staff now had contact only with their own departments and received less individual attention, Mulliken says. People started to get snippy with each other. You could see it was going to be a stressful situation."Exercise: To help employees get to know each other on a personal level and retain the company's cohesive culture, Mulliken introduced a scavenger hunt type game. Employees write down five little- known facts about themselves in a notebook, and copies of the booklet are passed around to everyone. The idea is to pin the facts to the person. Employees walk around the room and speak with each other to ferret out clues. The game lasts a few hours, and then the correct answers are revealed. It's a mega version of one of those party icebreakers," Mulliken says. We ran it almost like speed- dating," Mulliken says. It worked phenomenally well, and we've continued to do it every couple of months." Expert advice: This kind of exercise can help workers get to know each other, Mishra says. But it's best to ask employees to mention favorite hobbies, travel spots or other general information. One risk of this company's approach is that some of the personal information that could be shared could be quite sensitive," Mishra says. Related: Need Help Retaining Employees? Some Apps for That. Ultimate Guide to Team Building Activities That Don't Suck. In one of my past companies, we hired a virtual intern using one of the larger remote.. Team Building | WITS Corporate Teambuilding Workshops. At Workplace Interactive Team Building Seminars (WITS),our approach is to provide unique and innovative team building that enables individuals and groups to achieve their personal and team goals .. Our skilled team has facilitated hundreds of team buildings across the country. At WITS, we draw from nearly 1. And our client testimonials speak volumes on the importance of our unmatched approach. Whether your focus is team building and communication, managing stress or just blowing off some steam, our facilitators will create the perfect workshop for your organization. Nobody wants to sit and listen to some high- priced guru's theory of teamwork building. Our method of teambuilding activities are a hands- on- get- out- of- your- chair, have FUN approach and our exercises have the spirit and competitive nature of college drinking games (only without the drinking). And in a fun, non- threatening way, we quickly get everyone involved at the same time. So what are you waiting for? Get ready to laugh and become a teamwork building superstar. Get in touch with us today and start the process to a better, more cohesive team. Benefits of team building can include: Improving overall relationships and feeling of belonging. Defining the strengths and areas of improvement for your team members. Increasing skills and leadership within your team. Decreasing employee turnover and training time. Developing stronger communication and participation.
0 Comments
Best Cities in California for Young Adults 1. a place where many young people. if you want a safe, youth-friendly place to live—and make a good living. The cheapest places to live are also the most. The Central Valley of California is starting to sound like a. He explain it is the world cheapest place. So where are the best places to live in Orange County? California is Officially the Coolest Place to Live. Rental-Living.com on Twitter;. Find the best cities and neighborhoods to live in California for. California is truly an international place as millions. best places to live in California. The cheapest places to live in the world. Are you tired of busy cities, crowded streets, high rents and almost non- affordable mortgage? ![]() Well…there are places in the world where you can live well for less. The cheapest places to live are also the most beautiful and exotic destinations. So why not make your dreams come true, pack your bags and move to one of those paradise locations, if not for a lifetime, then at least for a year or two? There are two simple rules to follow while searching for low cost destinations. Firstly: if you find a place cheap enough to travel to, then most probably you will also find it cheap to live in. Secondly: wherever you are, the further from the big cities and large agglomerations, the cheaper it gets. Of course ‘cheap’ is a very relative concept, and what is cheap for you may not be cheap for people living some place else in the world. But if ‘cheap’ means spending just a few dollars/euro/pounds a day, then these locations in Asia and Central America may interest you…THAILANDHave you ever been to Thailand? Do you remember that feeling of paying $1 (€0. Did you ask yourself then what it would feel like to pay that much for a drink back home? Or the other way round… what would it feel like to enjoy such prices on a daily basis? If your answers are yes, yes, yes …then why not consider moving to the Land of Smiles for a while? Life is short and, really, no one forces you to spend your days sitting in the office with a computer as your best friend. Think about sandy beaches, constant sunshine and excellent food and realize that you can have it all for less than $5. Of course this amount will not pay a beach apartment but you can easily find cheap accommodation in places as beautiful as Chang Mai, up north, where you will pay around $3. Nearer the coast, a room in the apartments runs at roughly $9. Cooking at home will cost you nothing as fruits, vegetables and meat at the local markets fall into the budget category. If you are too lazy to cook then try excellent Thai food from street- side food stalls. You can get spicy chicken with rice or noodles for around $1 (€0. Spending around $2. CAMBODIAThinking about Cambodian history, the bloody regime of Pol Pot and poverty, no one would dare to call the country a paradise, but in terms of living cost Cambodia rivals Thailand. It does not have as great beaches as its Thai neighbor but, well, it is not all about beaches, right? You can easily live for less than $5. Phnom Penh. As there are more and more foreigners living in the town, the accommodation prices are getting higher – it would be hard to find something below $2. With $3. 00 (€2. 13) left, you can easily get by in the country. The food prices are similar or lower than in Thailand. ![]()
Eating in local restaurants will cost you around $2 (€1. Traveling by tuk tuk will cost you several bucks/euro a day. Living in Phnom Penh, the town of no Mc. Donald’s and Starbucks, may be a life changing experience for you. Be aware that Cambodians are extremely poor but modest people, so treat them with respect. Getting to know a few natives may help you to understand the complex history and tough life in the country. You can always teach English or get involved with some non- governmental organizations to help change the reality around you. For visa details read an article at www. You will find similar costs of living in nearby countries such as Vietnam and Laos. PHILIPPINESAnother exotic destination where life will cost you not more than $5. Philippines. Following the rule of getting away from big cities, Manila is not an option, as a rent prices start at $3. But if you head for Cebu, one of the most developed provinces in the Philippines, with sandy beaches, golf courses and great shopping, you can get an apartment for $1. In other bustling towns, such as Damaguete City, you can easily rent a room for around $4. Food is also cheap. Moreover, the Philippines offer a special resident retiree visa that you can get as early as at the age of 3. K in a bank there. At the age of 5. 0 and above you have to deposit $1. K and prove a monthly pension of $8. K couple). Malaysia, has a similar retiree offer called My Second Home program. COSTA RICAJust a few dollars/euro would be enough to survive in Costa Rica. And surviving in Costa Rica may be just a pleasure. The land has 1. 2 different climatic zones and abundant wildlife, but in general, the weather is hot tropical and the natives (called Ticos) are very spirited and friendly people. Prices in San José are low – the cost of goods and services is among the lowest of all cities throughout the world. You can easily live on $5. Obviously the further away from San José, the lower the cost of housing. Around 7. In the restaurants you can have an excellent meal with desert for about $4. And if you buy food at local markets and from the street vendors, you pay less- a bunch of bananas will cost you $0. Cigarettes are only about $1. In general, the prices in supermarkets are 3. While in Costa Rica you can learn or develop your surfing skills as the coast has great breaks and excellent surf conditions. And if you’re not too lazy, you can learn or practice your Spanish. Lessons will cost you much less than back home or in Spain. To find out more check the blog by Tim, who has lived in the country for several years. It seems that he knows a lot about living in Costa Rica. If you seriously think about moving to Costa Rica, you should also read ‘Living Abroad in Costa Rica’ by Erin Van Rheenen, who herself moved to live there and wrote from experience. The book explores the country’s history and culture, describes the nation and, of course, suggests a reconnaissance trip to Costa Rica before you decide to move. BELIZEYour dream of a personal heaven for a bargain price may also come true in Belize, which is considered one of the most beautiful countries in Central America. It has it all: great beaches, subtropical climate, and diverse wildlife. The official language in the country is English – that makes things simpler, doesn’t it? The country is also a paradise for scuba diving and snorkeling lovers . The Belize Barrier Reef offers 1. Cayes (islands) where you will find the best preserved marine ecosystems in the world. The costs of living are similar to those in Costa Rica. For a large house in Cayo district, a one- hour drive west from Belize City, you may pay $3. Groceries are cheap when bought locally. Imported stuff is in general 5. If you’re 4. 5 or more you may consider retiring to Belize. The Retired Person’s Incentive Program may allow you to live a tax free lifestyle, which should definitely help you save up a few bucks. Before you pack your bags, be aware that the country has dry and wet seasons so the weather is not always as perfect as you wish. The wet season starts in May and ends in October – it rains all the time and the hurricanes may occur, so if you want to spend just a few months in the country, go between November and April. The world is changing fast and the bargain destinations may soon become less affordable, so go there before it is too late. And don’t forget that the best things in life are for free. Living abroad for less than $5. There are also countries in Europe and Africa where you can live for $5. So keep checking the blog… the article is coming soon. P. S. At the time of writing, the exchange rate was $1 – €0. Best CALIFORNA city for a young adult? San Diego, San Francisco: crime, neighborhoods) - California. San Francisco, L. A. or San Diego. Many on here would say only SF or SD out of these options because of L. A traffic, crime and the stereotypical "hollywood" attitude, but certain parts of L. A. are really cool and really fun. SF is a alternative lifestyle, hipster, techie, coffee drinking, dive bar, art scene, foodie, type of place with chilly weather and a lot of things to do. SD is really just a very very large beach town, that oddly doesn't feel very large at all and it's a odd but harmonious mix of military, college town (there are three major colleges and several smaller ones), and laid back San Diego locals. It has a fun bar scene and it's NEVER WINTER. Nor. Cal's cheapest, most expensive places to live. The median price for a home in Modesto was $1. In Davis, the price was $5. Those two markets represent the low and high of 5. See which areas in Northern California fall in between. The data used for this slideshow came from the U. S. Census Bureau, 2. PHOTO: i. Stock / Devonyu. The median price for a home in Modesto is $1. PHOTO: tctahoe. 99/ulocal. The median price for a home in Citrus Heights is $1. PHOTO: capt. 61/ulocal. The median price for a home in Manteca is $1. The median price for a home in Live Oak is $1. PHOTO: ivamensucceednet/ulocal. The median price for a home in Marysville is $1. PHOTO: adjb. 86/ulocal. The median price for a home in Plymouth is $1. PHOTO: Dave. In. Plymouth/ulocal. The median price for a home in Loyalton is $1. PHOTO: ebirkeland/ulocal. The median price for a home in Turlock is $1. PHOTO: ulocal. The median price for a home in Ceres $1. PHOTO: riverbankmarina/ulocal. The median price for a home in Williams is $2. PHOTO: Julie. Cano/ulocal. The median price for a home in Portola is $2. PHOTO: scottnugget/ulocal. The median price for a home in Riverbank $2. PHOTO: niki_churchill/ulocal. The median price for a home in Stockton is $2. The median price for a home in Yuba City is $2. PHOTO: popeye. 3/ulocal. The median price for a home in Newman is $2. PHOTO: D_Dupont/ulocal. The median price for a home in Wheatland is $2. PHOTO: cindyh. 91. The median price for a home in Sacramento is $2. PHOTO: karmy. 91. The median price for a home in Folsom is $2. PHOTO: mikeray/ulocal. The median price for a home in Colusa is $2. PHOTO: Julie. Cano/ulocal. The median price for a home in Isleton is $2. PHOTO: shannonly. The median price for a home in Lodi is $2. PHOTO: drlodi/ulocal. The median price for a home in Oakdale $2. PHOTO: Marie. Salomon/ulocal. The median price for a home in Elk Grove is $2. PHOTO: fotopaul/ulocal. The median price for a home in Hughson is $2. PHOTO: terri. 77/ulocal. The median price for a home in Rancho Cordova is $2. The median price for a home in Tracy is $2. PHOTO: illoca/ulocal. The median price for a home in Fair Oaks is $2. PHOTO: Vivirmorethanjustimages/ulocal. The median price for a home in Carmichael is $2. PHOTO: Wood. Mc/ulocal. The median price for a home in Lathrop is $2. PHOTO: Tinneke/ulocal. The median price for a home in Angels Camp is $2. PHOTO: Connie. Mc. Camey/ulocal. The median price for a home in West Sacramento is $2. PHOTO: Shootin. Mickey/ulocal. The median price for a home in Ione is $2. PHOTO: TFisher/ulocal. The median price for a home in Jackson in $3. PHOTO: Photos. By. MIKE/ulocal. The median price for a home in Escalon is $3. PHOTO: marianm/ulocal. The median price for a home in Galt is $3. PHOTO: tactilephoto/ulocal. The median price for a home in Roseville is $3. PHOTO: selky. 60/ulocal. The median price for a home in Colfax is $3. PHOTO: Pix. By. Nancy/ulocal. The median price for a home in Sonora is $3. PHOTO: Slimpick/ulocal. The median price for a home in Placerville is $3. The median price for a home in Rio Vista is $3. The median price for a home in Suisun City is $3. PHOTO: Peter_Duch/ulocal. The median price for a home in Grass Valley is $3. PHOTO: gr. 8stuf/ulocal. The median price for a home in Winters is $3. PHOTO: KGibb. 54. The median price for a home in Lincoln is $3. PHOTO: raylor. 4/ulocal. The median price for a home in Vallejo is $3. PHOTO: moestewart/ulocal. The median price for a home in Woodland is $3. The median price for a home in Sutter Creek is $3. PHOTO: Deni. Mari/ulocal. The median price for a home in Vacaville is $3. PHOTO: wick/ulocal. The median price for a home in Ripon is $3. PHOTO: Wes. V/ulocal. The median price for a home in Loomis is $3. PHOTO: Kismet_Photos/ulocal. The median price for a home in Fairfield is $3. PHOTO: willrey/ulocal. The median price for a home in Dixon is $3. PHOTO: ulocal/Brian. Hickey. The median price for a home in Rocklin is $4. PHOTO: peachyhiker/ulocal. The median price for a home in Amador City is $4. PHOTO: olivialu/ulocal. The median price for a home in Auburn is $4. PHOTO: ffgphotos_com/ulocal. The median price for a home in Nevada City is $4. PHOTO: Grandma. Moose/ulocal. The median price for a home in Benicia is $5. The median price for a home in Truckee is $5. PHOTO: At. Lake. Tahoe/ulocal. The median price for a home in Davis is $5. PHOTO: markr. 42. Ordliste - NHI. no. Medikamentgruppe som brukes i behandlingen av ulcerøs kolitt og Crohns sykdom (= 5- aminosalisylsyre)5- fu. A indikerer en sterk anbefaling. MMR står for meslinger (measles), kusma (mumps) og røde hunder (rubella). MMR-vaksinen beskytter barn mot disse sykdommene. MMR står for meslinger (measles), kusma (mumps) og røde hunder (rubella). MMR-vaksinen beskytter barnet mot disse sykdommene. Vaksinen. *Vist hos barn, usikkert i hvor stor grad det gjelder for voksne og eldre. Konjugert pneumokokkvaksine. Pneumokokkonjugatvaksine (PKV) består av kapselpolysakkarid. Gradering av anbefalinger nivå A indikerer en sterk anbefaling. Forskningen denne anbefalingen bygger på er av høyeste kvalitet, og det er liten risiko for at. Forskningen denne anbefalingen bygger på er av høyeste kvalitet, og det er liten risiko for at ytterligere forskning skal endre denne anbefalingenaa amyloidose. Systemisk amyloidose er en sykdom som skyldes avleiringer, og AA amyloidose er forårsaket av avleiringer av akutt fase proteinet "amyloid A" eller "SSA" (serum amyloid A). Denne varianten av sykdommen er som regel sekundær til en kronisk betennelseaaa. OBS! En overflod av forkortelser benyttes i medisinen, vær derfor oppmerksom på at denne forkortelsen kan ha en annen mening enn følgende: abdominalt aorta aneurismeaai. OBS! En overflod av forkortelser benyttes i medisinen, vær derfor oppmerksom på at denne forkortelsen kan ha en annen mening enn følgende: Ankel- arm- indeks = systolisk blodtrykk i ankel delt på systolisk blodtrykk armaat. OBS! En overflod av forkortelser benyttes i medisinen, vær derfor oppmerksom på at denne forkortelsen kan ha en annen mening enn følgende: alfa. Brukes bl. a. ved hjerteinngrep hvor man fjerner fokus for rytmeforstyrrelser.
Også brukt ved fjerning av kroppsdeler. Verdien er mellom 0 og 1, eller den uttrykkes i prosent. Risiko kan vise til både uheldige og gunstige (eks. ARR) Den absolutte forskjellen i risiko mellom eksperiment- og kontrollgruppen i et forsøk. Verdien brukes når riskoen i kontrollgruppen overgår risikoen i eksperimentgruppen. Tallet kalkuleres ved å trekke AR i eksperimentgruppen fra AR i kontrollgruppen. Tallet gir ikke informasjon om den forholdsvise reduksjonen mellom de to gruppene. For det behøves relativ risiko (RR). ARI) Den absolutte forskjellen i risiko mellom eksperiment- og kontrollgruppen i et forsøk. Brukes når risikoen i eksperimentgruppen overgår risikoen i kontrollgruppen. Verdien kalkuleres ved å trekke AR i kontrollgruppen fra AR i eksperimentgruppen. Dette tallet gir ikke noen informasjon om den forholdsvise økningen mellom to grupper. For det behøves relativ risiko (RR). OBS! En overflod av forkortelser benyttes i medisinen, vær derfor oppmerksom på at denne forkortelsen kan ha en annen mening enn følgende: angiotensin converting enzymeace- hemmerhemmere av angiotensin converting enzyme, blodtrykksmedisinacetabulumhofteskålen, befinner seg i hoftebeinet (ileum)acetaminofenparacetamol (N- acetyl- p- aminofenol)acetonstoff som dannes under nedbrytingen av karbohydrater, økte mengder er unormalt og forbindes med syreforgiftning ved sukkersyke, keton, har en blomsterliknende duftacetylsalisylsyreinnholdsstoffet i Globoid, Novid, Albyl, Dispril etc.; er smertestillende, febernedsettende, betennelsesdempende og motvirker dannelse av blodpropp. Forkortes ofte til ASA (acetylsalicylic acid)aciditetsurhetsgradacidosesyreforgiftning, opphopning av syre i blodet, redusert p. H i blodetacnekviser, filipenseracr. OBS! En overflod av forkortelser benyttes i medisinen, vær derfor oppmerksom på at denne forkortelsen kan ha en annen mening enn følgende: albumin creatinin ratio, metode for tidlig påvisning av nyresykdomacromioclaviculærleddleddet mellom skulderbladet og kragebeinetacth. OBS! En overflod av forkortelser benyttes i medisinen, vær derfor oppmerksom på at denne forkortelsen kan ha en annen mening enn følgende: adrenokortikotropt hormon, produseres i hypofysens forlapp, regulerer binyrebarkens hormonproduksjonad/hd. OBS! En overflod av forkortelser benyttes i medisinen, vær derfor oppmerksom på at denne forkortelsen kan ha en annen mening enn følgende: "attention deficit/hyperactivity disorder", hyperkinetiske forstyrrelser, atferdsforstyrrelser hos barn preget av uoppmerksomhet og hyperaktivitetadaptasjontilvenning, tilpassingadd. OBS! En overflod av forkortelser benyttes i medisinen, vær derfor oppmerksom på at denne forkortelsen kan ha en annen mening enn følgende: "attention deficit disorder", oppmerksomhetsforstyrrelse uten hyperaktivitet hos barnaddictioavhengighet, f. Tilstanden ble første gang diagnostisert i 1. Thomas Addisonadditiv effektstoffer som virker sammen og gir samlet større effekt enn hver av stoffene giradduksjoninnoverføring (motsatt av abduksjon)adduktormuskel som bidrar til bevegelser innoveradekvattilstrekkeligadenektomerefjerne en lymfekjerteladenektomifjerning av en eller flere kjertler, særlig brukt om fjerning av lymfekjertleradenittbetennelse i en kjertel, lymfekjerteladenoidkjertelliknendeadenoidektomifjerning av falske mandler i bakre del av nesenadenomgodartet kjertelsvulst, f. OBS! En overflod av forkortelser benyttes i medisinen, vær derfor oppmerksom på at denne forkortelsen kan ha en annen mening enn følgende: antidiuretisk hormon (vasopressin), hormon som demper urinproduksjonen. Skal normalt produseres særlig om natten - karsammentrekkende og antidiuretisk hormon som bidrar til å konsentrere urinenadheransesammenvoksing etter f. OBS! En overflod av forkortelser benyttes i medisinen, vær derfor oppmerksom på at denne forkortelsen kan ha en annen mening enn følgende: adenosin bifosfatadpkd. OBS! En overflod av forkortelser benyttes i medisinen, vær derfor oppmerksom på at denne forkortelsen kan ha en annen mening enn følgende: autosomal dominant polycystisk nyresykdomadrenalinhormon som utskilles fra binyrene, mobiliseres ved "kampsituasjoner" og "stress", stimulerer det sympatiske nervesystemadrenergadrenalindannende, ev. Brukes bl. a. som administrasjonsform for astmamedisinerafakimangel på øyelinse, f. Ekspressiv afasi - manglende evne til å uttrykke seg. Sensorisk afasi - manglende evne til å forstå meningen bak ordafebrilfeberfriaffeksjonpåvirkning, forstyrrelse av, sykelig tilstandaffektsterkt følelsesutbruddaffektivbrukt i forbindelse med sinnslidelser: Lidelser som først og fremst gir plager fra følelseslivet, som påvirker humøret, gir stemningsforstyrrelser, innbefatter blant annet manisk- depressiv (bipolar) sinnslidelse og ren depresjonaffektive sinnslidelserpsykiske lidelser som påvirker følelsesliv og humør, stemningsforstyrrelseraffektkrampekramper som utløses av kraftige stemningsforstyrrelser, f. Skyldes ikke epilepsi. Det er særlig små barn som rammesaffektlabilpsykisk tilstand hvor man reagerer med uvanlig sterke følelsesutslag (gråt, sinne) ved selv små hendelserafferenttilførende, som fører inn mot midtenaffinitetstoffers tilbøyelighet til å reagere med hverandreaffirm. The Atrial Fibrillation Follow- up Investigation of Rhythm Management (AFFIRM). Er den største kvalitetsstudien der man har sammenlignet effekten av rytme- og frekvenskontroll ved atrieflimmeraffiserevedrøreafonitap av stemme, f. OBS! En overflod av forkortelser benyttes i medisinen, vær derfor oppmerksom på at denne forkortelsen kan ha en annen mening enn følgende: alfa. Er uttrykk for den totale perifere karmotstanden. Agonister utøver en handling, antagonister gjør det motsatte - blokkerer handlingen. Anatomi: muskel som virker i en retning, antagonist- muskler virker i motsatt retning. Farmakologi: Stoff (f. OBS! En overflod av forkortelser benyttes i medisinen, vær derfor oppmerksom på at denne forkortelsen kan ha en annen mening enn følgende: avansert hjertelungeredningaids. OBS! En overflod av forkortelser benyttes i medisinen, vær derfor oppmerksom på at denne forkortelsen kan ha en annen mening enn følgende: "acquired immune deficiency syndrome", ervervet immunsvikt- syndromain. OBS! En overflod av forkortelser benyttes i medisinen, vær derfor oppmerksom på at denne forkortelsen kan ha en annen mening enn følgende: akutt interstitiell nefritt, akutt betennelse i nyreneaip. OBS! En overflod av forkortelser benyttes i medisinen, vær derfor oppmerksom på at denne forkortelsen kan ha en annen mening enn følgende: akutt intermitterende porfyriaitp. OBS! En overflod av forkortelser benyttes i medisinen, vær derfor oppmerksom på at denne forkortelsen kan ha en annen mening enn følgende: autoimmun trombocytopeni, lavt antall blodplater pga. CO2) i blod eller vev. For rask/kraftig åndedrett vil føre til akapniakarinoseen hvilken som helst sykdom fremkalt av midd, f. Enkelte øyedråper (atropin) forårsaker slik lammelseakkomoderinginnstilling av synet på skarpt synakkumulasjonopphopningaknekviserakrocyanoseblåfargning av ytre deler av lemmene, brukes særlig om fingre og tærakromegalisykdom med økt utskillelse av veksthormon som fører til at visse deler av skjelettet fortsetter å vokse i voksen alder, eks. Immunoglobulin "light chain" amyloidose, tidligere omtalt som primær amyloidose. Amyloidose er en tilstand hvor det oppstår avleiringer i kroppen, og ved AL amyloidose består disse avleiringene av fragmenter fra spesifikke deler av et immunoglobulinalat. OBS! En overflod av forkortelser benyttes i medisinen, vær derfor oppmerksom på at denne forkortelsen kan ha en annen mening enn følgende: alanin aminotransferase, et leverenzym som kan brukes som et mål på leverfunksjonenalbinismemedfødt mangel på fargepigment; hud, hår og øyne rammes, hvitfarging (øynene reflekterer øyebunnen og fremstår som røde)albumindet vanligste transportproteinet i blodetaldosteronhormon som regulerer salt- og mineralbalansen i kroppen, skilles ut fra binyrenealdosteronantagonistet legemiddel som motvirker aldosteronaleksitymibetegnelse på folk som mangler evne til å finne ord for hva de kjenner og hvordan de har det, som mangler evne til å bruke fantasialeukocytosemangel på hvite blodlegemeralfa- adrenerg reseptorspesifikk reseptor (mottaker) i nerveende i det sympatiske nervesystem som lar seg stimulere av adrenalin og noradrenalinalfa. Et protein som dannes under svangerskap, forhøyede verdier kan indikere fosterskade. Høye verdier sees også bl. H- verdi over 7alkaloidbasiske, nitrogenholdige stoff som finnes i planteralkalosebaseopphopning i organismenalkoholenhetmål på bruk av alkohol, tilsvarer 1. Tommelfingerregel: en enhet tilsvarer en liten flaske pils (3. Tico. Vac, Tico. Vac Junior «Pfizer» - Felleskatalogen. Miljørisiko i Norge. INJEKSJONSVÆSKE, suspensjon i ferdigfylt sprøyte: Tico. Vac: 1 dose (0,5 ml) inneh.: Skogflåttencefalittvirus. TBE- virus) (stamme Neudørfl) 2,4 μg. Dyrket i kulturer av kyllingembryofibroblastceller. CEF- celler), adsorbert til aluminiumhydroksid, hydrert (0,3. Al. 3+), humanalbumin, natriumklorid, dinatriumfosfatdihydrat. INJEKSJONSVÆSKE, suspensjon i ferdigfylt sprøyte: Tico. Vac Junior: 1 dose (0,2. Skogflåttencefalittvirus. TBE- virus) (stamme Neudørfl) 1,2 μg. Dyrket i kulturer av kyllingembryofibroblastceller. CEF- celler), adsorbert til aluminiumhydroksid, hydrert (0,1. Al. 3+), humanalbumin, natriumklorid, dinatriumfosfatdihydrat. Indikasjoner. Tico. Vac: Vaksinasjon mot skogflått- overført. TBE) av personer ≥1. Tico. Vac Junior: Vaksinasjon mot skogflått- overført encefalitt (TBE) av barn > 1- 1. Generelt: Begge vaksinene skal gis iht. TBE. Dosering Primærvaksinasjonsskjema: Voksne og barn > 1 år: Består av 3 doser. Etter 1. dose bør 2. Dersom rask immunrespons er nødvendig kan. Etter de 2 første dosene kan tilstrekkelig. Etter 3. dose kan beskyttelse forventes i minst. For å oppnå immunitet før flåttsesongen starter, om våren, bør. Vaksinasjonsskjemaet. Grunn- immunisering. Dose barn 1- 1. 5 år(Tico. Vac Junior)Dose voksne og barn ≥1. Tico. Vac)Vanlig skjema. Hurtig immuniserings- skjema. Valgt dato. Valgt dato. Boosterdoser: Voksne og barn > 1 år: 1. Ytterligere boosterdoser skal gis hvert 5. Generelt skal ikke intervallet mellom boosterdoser overstige 3 år. Boosterdose. Dose. Tid. Barn 1- 1. 5 år (Tico. Vac. Junior): 1. boosterdose. Påfølgende boosterdoser. Hvert 5. år. Voksne og barn > 1. Tico. Vac): 1. boosterdose. Påfølgende boosterdoser. Hvert 5. år. Eldre ≥6. Tico. Vac): Alle boosterdoser. Hvert 3. årÅ utvide intervallet mellom noen av dosene (primærvaksinasjonsskjemaet. Dersom vaksinasjonsskjemaet blir avbrutt etter minimum 2 foregående. Barn < 6 år: Ingen tilgjengelige. Spesielle pasientgrupper: Voksne og barn med nedsatt immunforsvar. Ingen kliniske data å basere doseanbefalinger. Antistoffkonsentrasjonen bør bestemmes 4 uker etter 2. Det samme gjelder for enhver påfølgende dose. Tilberedning/Håndtering: La vaksinen oppnå romtemperatur før den gis. Vaksinen skal. ristes godt før bruk for å oppnå en «offwhite» blakket. Kast vaksinen dersom partikler. Skal ikke blandes med andre legemidler. Pakningen kan inneholde 1 eller ingen kanyle. Kanylen er steril og. Administrering: Gis i. Gis ev. i. m. i lårmuskelen (vastus lateralis) hos barn < 1. Skal ikke gis intravaskulært. Kontraindikasjoner. Overfølsomhet for innholdsstoffene eller rester. Kryssallergi mot andre aminoglykosider enn neomycin og gentamycin. Alvorlig overfølsomhet (f. TBE- vaksinering. Forsiktighetsregler Feber kan inntreffe hos barn, spesielt de yngste. Feber er mindre vanlig. Antipyretisk profylakse eller behandling. Adekvat medisinsk behandling og utstyr skal. På bakgrunn av dette bør den vaksinerte være under overvåkning i en. Intravaskulær administrering må unngås. Ikke- alvorlig allergi mot eggproteiner er normalt ingen kontraindikasjon. Beskyttende immunrespons oppnås ikke alltid. Dersom det anses. Dette. skyldes at kryssreaksjon med preeksisterende antistoffer pga. Dengue- virus) kan gi falske positive. Ved kjent eller mistenkt autoimmun sykdom, må risikoen. TBE- infeksjon veies opp mot risikoen for at vaksinen kan ha uheldig. Grundig vurdering skal foretas ved. Det er. mulig at vaksinen ikke gir fullstendig beskyttelse av den vaksinerte. Et flåttbitt kan også overføre andre infeksjoner enn TBE, inkl. TBE. TBE- vaksiner beskytter ikke mot Borrelia- infeksjon. En vaksinert person. TBE- infeksjon skal derfor. Hjelpestoffer: Kalium- og natriumnivåene er < 1 mmol/dose, det vil i praksis. Bilkjøring/maskinbruk: Antas ikke å påvirke evnen til å kjøre bil eller bruke maskiner. Interaksjoner For utfyllende informasjon fra Legemiddelverket om relevante interaksjoner, se J0. B A0. 1Liste over interaksjoner (4 treff): Vaksiner J0. Allergenekstrakter V0. A AVis detaljer. Klinisk konsekvens. Risiko for endret immunrespons. Interaksjonsmekanisme. Den immunologisk reaksjonen på allergenet kan interferere med reaksjonen på vaksinen. Justering av doseringstidspunkt. Det bør gå minst en uke fra siste injeksjon med et allergen til en vaksine gis, hvis ikke indikasjojnen er essensiell. Neste injeksjon med allergen(- er) kan da fortsette etter tre uker, men redusering av dosene med ett dosetrinn. Kildegrunnlag. Indirekte data. Vaksiner, inaktiverte. J0. 7A E0. 1 - Kolera, inaktivert, helcelle. J0. 7A F0. 1 - Difteritoksoid. J0. 7A G0. 1 - Hemophilus influenzae B, renset antigen konjugert. J0. 7A H0. 3 - Meningokokk A,C, divalent renset polysakkarid antigen. J0. 7A H0. 4 - Meningokokk A,C,Y,W- 1. J0. 7A H0. 7 - Meningokokk C, renset polysakkarid antigen konjugert. J0. 7A H0. 8 - Meningokokk A,C,Y,W- 1. J0. 7A H0. 9 - Meningokokk B, mulitkomponent vaksine. J0. 7A J5. 1 - Kikhoste, inaktivert, helcelle, kombinasjoner med toksoider. J0. 7A J5. 2 - Kikhoste, renset antigen, kombinasjoner med toksoider. J0. 7A L0. 1 - Pneumokokk, renset polysakkarid antigen. J0. 7A L0. 2 - Pneumokokk, renset polysakkarid antigen konjugert. J0. 7A L5. 2 - Pneumokokk, renset polisakkarid antigen og Hemophilus influenzae, konjugert. J0. 7A M0. 1 - Tetanustoksoid. J0. 7A M5. 1 - Tetanustoksoid, kombinasjoner med difteritoksoid. J0. 7A P0. 3 - Tyfoid, renset polysakkarid antigen. J0. 7B A0. 1 - Encefalitt, skogflåttbåren, inaktivert helvirus. J0. 7B A0. 2 - Japansk encefalitt, inaktivert helvirus. J0. 7B B0. 1 - Influensa, inaktivert, helvirus. J0. 7B B0. 2 - Influensa, renset antigen. J0. 7B C0. 1 - Hepatitt B, renset antigen. J0. 7B C0. 2 - Hepatitt A, inaktivert, helvirus. J0. 7B C2. 0 - Kombinasjoner. J0. 7B F0. 3 - Poliomyelitt, trivalent, inaktivert helvirus. J0. 7B G0. 1 - Rabies, inaktivert, helvirus. J0. 7B M0. 1 - Papillomavirus (human type 6,1. J0. 7B M0. 2 - Papillomavirus (human type 1. J0. 7C A0. 2 - Difteri- kikhoste- poliomyelitt- tetanus. J0. 7C A0. 4 - Hemophilus influenzae B og poliomyelitt. J0. 7C A0. 6 - Difteri- Hemophilus influenzae B- kikhoste- poliomyelitt- tetanus. J0. 7C A0. 8 - Hemophilus influenzae B og hepatitt BJ0. C A0. 9 - Difteri- Hemophilus influenzae B- kikhoste- poliomyelitt- tetanus- hepatitt BJ0. C A1. 0 - Tyfoid- hepatitt ACytotoksiske midler. L0. 1A - Alkyleringsmidler. L0. 1A A - Sennepsgassanaloger. L0. 1A A0. 1 - Syklofosfamid. L0. 1A A0. 2 - Klorambucil. L0. 1A A0. 3 - Melfalan. L0. 1A A0. 5 - Klormetin. L0. 1A A0. 6 - Ifosfamid. L0. 1A A0. 7 - Trofosfamid. L0. 1A A0. 8 - Prednimustin. L0. 1A A0. 9 - Bendamustin. L0. 1A B - Alkylsulfonater. L0. 1A B0. 1 - Busulfan. L0. 1A B0. 2 - Treosulfan. L0. 1A B0. 3 - Mannosulfan. L0. 1A C - Etyleniminer. L0. 1A C0. 1 - Tiotepa. L0. 1A C0. 2 - Triazikon. L0. 1A C0. 3 - Karbokon. L0. 1A D - Nitrosoureaforbindelser. L0. 1A D0. 1 - Karmustin. L0. 1A D0. 2 - Lomustin. L0. 1A D0. 3 - Semustin. L0. 1A D0. 4 - Streptozocin. L0. 1A D0. 5 - Fotemustin. L0. 1A D0. 6 - Nimustin. L0. 1A D0. 7 - Ranimustin. L0. 1A G - Epoksider. L0. 1A G0. 1 - Etoglucid. L0. 1A X - Andre alkyleringsmidler. L0. 1A X0. 1 - Mitobronitol. L0. 1A X0. 2 - Pipobroman. L0. 1A X0. 3 - Temozolomid. L0. 1A X0. 4 - Dakarbazin. L0. 1B - Antimetabolitter. L0. 1B A - Folsyreanaloger. L0. 1B A0. 1 - Metotreksat. L0. 1B A0. 3 - Raltitreksed. L0. 1B A0. 4 - Pemetreksed. L0. 1B A0. 5 - Pralatreksat. L0. 1B B - Purinanaloger. L0. 1B B0. 2 - Merkaptopurin. L0. 1B B0. 3 - Tioguanin. L0. 1B B0. 4 - Kladribin. L0. 1B B0. 5 - Fludarabin. L0. 1B B0. 6 - Klofarabin. L0. 1B B0. 7 - Nelarabin. L0. 1B C - Pyrimidinanaloger. L0. 1B C0. 1 - Cytarabin. L0. 1B C0. 2 - Fluorouracil. L0. 1B C0. 3 - Tegafur. L0. 1B C0. 4 - Karmofur. L0. 1B C0. 5 - Gemcitabin. L0. 1B C0. 6 - Kapecitabin. L0. 1B C0. 7 - Azacitidin. L0. 1B C0. 8 - Decitabin. L0. 1B C5. 2 - Fluorouracil, kombinasjoner. L0. 1B C5. 3 - Tegafur, kombinasjoner. L0. 1B C5. 9 - Trifluridin, kombinasjoner. L0. 1C - Plantealkaloider og andre naturprodukter. L0. 1C A - Vinkaalkaloider og analoger. L0. 1C A0. 1 - Vinblastin. L0. 1C A0. 2 - Vinkristin. L0. 1C A0. 3 - Vindesin. L0. 1C A0. 4 - Vinorelbin. L0. 1C A0. 5 - Vinflunin. L0. 1C A0. 6 - Vintafolid. L0. 1C B - Podofyllotoksinderivater. L0. 1C B0. 1 - Etoposid. L0. 1C B0. 2 - Teniposid. L0. 1C C - Kolkisinderivater. L0. 1C C0. 1 - Demekolcin. L0. 1C D - Taksanes. L0. 1C D0. 1 - Paklitaksel. L0. 1C D0. 2 - Docetaksel. L0. 1C D0. 3 - Paklitakselpoliglumeks. L0. 1C D0. 4 - Kabazitaksel. L0. 1C X - Andre plantealkaloider og naturprodukter. L0. 1C X0. 1 - Trabektedin. L0. 1D - Cytotoksiske antibiotika og lignende substanser. L0. 1D A - Aktinomyciner. L0. 1D A0. 1 - Daktinomycin. L0. 1D B - Antracykliner og lignende substanser. L0. 1D B0. 1 - Doksorubicin. L0. 1D B0. 2 - Daunorubicin. L0. 1D B0. 3 - Epirubicin. L0. 1D B0. 4 - Aklarubicin. L0. 1D B0. 5 - Zorubicin. L0. 1D B0. 6 - Idarubicin. L0. 1D B0. 7 - Mitoksantron. L0. 1D B0. 8 - Pirarubicin. L0. 1D B0. 9 - Valrubicin. L0. 1D B1. 0 - Amrubicin. L0. 1D B1. 1 - Piksantron. L0. 1D C - Andre cytotoksiske antibiotika. L0. 1D C0. 1 - Bleomycin. L0. 1D C0. 2 - Plikamycin. L0. 1D C0. 3 - Mitomycin. L0. 1D C0. 4 - Iksabepilon. L0. 1X A - Platinaforbindelser. L0. 1X A0. 1 - Cisplatin. L0. 1X A0. 2 - Karboplatin. L0. 1X A0. 3 - Oksaliplatin. L0. 1X A0. 4 - Satraplatin. L0. 1X A0. 5 - Polyplatillen. L0. 1X B - Metylhydraziner. L0. 1X B0. 1 - Prokarbazin. L0. 1X C - Monoklonale antistoffer. L0. 1X C0. 1 - Edrecolomab. L0. 1X C0. 2 - Rituksimab. L0. 1X C0. 3 - Trastuzumab. L0. 1X C0. 5 - Gemtuzumab. L0. 1X C0. 6 - Cetuksimab. L0. 1X C0. 7 - Bevacizumab. L0. 1X C0. 8 - Panitumumab. L0. 1X C0. 9 - Catumaksomab. L0. 1X C1. 0 - Ofatumumab. L0. 1X C1. 1 - Ipilimumab. L0. 1X C1. 2 - Brentuksimabvedotin. L0. 1X C1. 3 - Pertuzumab. L0. 1X C1. 4 - Trastuzumabemtansin. L0. 1X C1. 5 - Obinutuzumab. L0. 1X C1. 6 - Dinutuksimab. L0. 1X C1. 7 - Nivolumab. L0. 1X C1. 8 - Pembrolizumab. L0. 1X C1. 9 - Blinatumomab. L0. 1X C2. 1 - Ramucirumab. L0. 1X C2. 2 - Necitumumab. L0. 1X C2. 3 - Elotuzumab. L0. 1X C2. 4 - Daratumumab. L0. 1X C2. 5 - Mogamulizumab. MMR - vaksinen - NHI. MMR står for meslinger (measles), kusma (mumps) og røde hunder (rubella). MMR- vaksinen beskytter barnet mot disse sykdommene. Vaksinen gis ved 1. Sykdomsomtaler. Meslinger. Meslinger (measles - forkortet M) er vår alvorligste "barnesykdom". Sykdommen er meget smittsom. Blant dem som vokste opp før vaksine ble tilgjengelig, fikk mer enn 9. Sykdommen begynner med forkjølelses symptomer og høy feber, etterfulgt av utslett. Meslinger følges ofte av komplikasjoner som lungebetennelse, bronkitt og mellomøre betennelse. Alvorlige følger som hjernebetennelse, varig hjerneskade og dødsfall forekommer. I hele verden dør over 7. Meslingeutbrudd med dødsfall forekommer blant uvaksinerte også i vår del av verden. Vil du vite mer om meslinger? Kusma. Kusma (Mumps - forkortet M) er en virusinfeksjon som gir feber og hevelse i ørespyttkjertlene. Den vanligste komplikasjonen er kusma- hjernehinnebetennelse, som oftest går over uten varige skader. En mer alvorlig komplikasjon er varig døvhet. Hvis gutter får kusma etter puberteten kan viruset angripe testiklene og føre til nedsatt fruktbarhet, men sannsynligvis ikke sterilitet. Vil du vite mer om kusma? Røde hunder. Røde hunder (rubella - forkortet R) er en mild sykdom med feber og utslett hos både barn og voksne. Men hvis en gravid kvinne som ikke er immun smittes med røde hunder, kan sykdommen føre til alvorlige skader på fosteret. Risikoen for misdannelser er over 8. Vanligste smittemåte for gravide kvinner er kontakt med barn som har sykdommen. Ved noen utbrudd har uvaksinerte menn vært smittekilder. Derfor er det viktig at alle barn vaksineres. Vil du vite mer om røde hunder? MMR- vaksine. Vaksinen mot meslinger, kusma og røde hunder er kjent under navnet MMR- vaksine. Forkortelsen kommer fra sykdommenes engelske navn; Measles (meslinger), Mumps (kusma) og Rubella (røde hunder). Vaksinen er en blandingsvaksine som består av levende, svekkete meslinge- , kusma- og røde hunder- virus. Etter første dose MMR, som vanligvis gis ved 1. En ny dose gis i 1. Det er ikke skadelig å vaksinere en person som allerede har hatt en eller flere av sykdommene. Bivirkninger. Kortvarige smerter, rødhet og hevelse på stikkstedet forekommer. De vanligste symptomene er feber og utslett. Infeksjon med vaksinevirus er ikke smittsom. De komplikasjonene som forekommer når man har sykdommene, forekommer uhyre sjelden etter vaksinasjon. I 1. 99. 7 ble det framsatt en hypotese om at MMR- vaksine kan være årsak til autisme. Det er senere gjennomført en rekke store undersøkelser, som alle taler sterkt imot at MMR- vaksine skulle være årsak til autisme eller noen annen form for hjerneskade. I 2. 00. 4 er artikkelen om mulig sammenheng mellom MMR og autisme trukket tilbake fra det anerkjente tidskriftet Lancet som opprinnelig publiserte artikkelen. Det er sterke mistanker om uredeligheter i bakgrunnsmaterialet. Vil du vite mer? Vil du vite mer om meslinger? Vil du vite mer om kusma? Vil du vite mer om røde hunder? Vaksinasjonsprogrammet i Norge. 9/14/2017 0 Comments Toy Story Tee Shirts For AdultsLike or Follow Character.com. Stay up to date with what’s new and find awesome special offers & discounts. Shop for toy story shirt on Etsy. Pizza Planet Tshirt, Toy Story Shirt, Toy Story Tee, Toy Story Tshirt. Toy Story TShirt, Toy Story Birthday, Disney Shirts. Shop Target for products you will love from toy+story. Tee shirts (5) Costume full body. This classic toy is made in easy to wear shapes with face options that. Disney T-Shirts, Clothing & Gifts - Official Disney. celebrate Pixar's first animation adventure with a Toy Story tee or. illiant Frozen T-Shirts. Visit the official Toy Story website to play games, find activities, browse movies, watch video, browse photo galleries, buy merchandise and more! Toy Story Tshirts, Hoodies, shirts and tee's from 1. TShirtsville. com. ![]() Toy Story I Am Woody Costume T- Shirt for Men"There's a snake in my boot!"Ah, Woody. America's favorite toy cowboy. Beloved by Andy for years, beloved by audiences for.. And now you too can look like the sweetest, bravest cowboy to ever have a pull string. Just pull this t- shirt on and explain to Buzz he's not a space ranger, he's just a toy. But he won't understand, and all the other toys seem to like him, so eventually you've got to realize he's a good guy, deep down. Of course, eventually Andy has to grow up.. Oh come on! We can't even do this. Did you see Toy Story 3?! It's heartbreaking, man. The whole office had to take a day off after that movie. What are we saying? You get it! That's why you're here. You love Woody too and you want to honor him like a true fan, with this freaking awesome T- shirt. Just watch as you walk down the street and people stop you to pull you into a hug, or to gush about their favorite moment from the movies, or just to wonder about Mr. Mrs. Potatohead and how that whole relationship is going. Toy Story Tshirts and thousands of rock, pop, metal and punk band t-shirts n hoodies.You've got a friend in us, partner. Officially licensed. Yellow crew neck shirt w/ Woody's clothes printed on front. Become your favorite Toy Story character in this Jessie costume t-shirt! This 100% cotton tee is printed to look just like Jessie the cowgirl from Toy Story. Get colorful and fun Toy Story shirts from Stylin' Online today. Our selection includes Disney clothing for men and Toy Story 2 alien tee shirts for adults. ![]() · Education Department says some 32 million U.S. adults lack basic. state and local levels prevents about 90 percent of the illiterate from getting. Percent of U.S. adults who can’t read (below a basic level). Percent of the worlds illiterate who are female: 66 %: Countries With the Highest Illiteracy Rates. Facts about Literacy in America | Do. Something. org. Welcome to Do. Something. org, a global movement of 5. The 1. 1 facts you want are below, and the sources for the facts are at the very bottom of the page. In response to a demand for estimates of the percentage of adults with low literacy in individual. for all states and counties in the United States in 2003 and. · The National Geographic–. In a nation called the world's superpower, only 17 percent of young adults in the United States could find Afghanistan. After you learn something, do something! Find out how to take action here. The U. S. Illiteracy Rate Hasn't Changed In 1. Years. Sunday is International Literacy Day! We recommend taking the opportunity to curl up with with a warm cup of coffee, a comfy chair, and a favorite classic. Of course, this holiday is bittersweet - We know we'll be celebrating accordingly, but many Americans won't be able to do so. According to a study conducted in late April by the U. S. Department of Education and the National Institute of Literacy, 3. U. S. can't read. That's 1. 4 percent of the population. U. S. read below a 5th grade level, and 1. The current literacy rate isn't any better than it was 1. According to the National Assessment of Adult Literacy (completed most recently in 2. Americans demonstrated a "below basic" literacy level in 2. We probably don't need to spell out the benefits of reading and writing for you. Economic security, access to health care, and the ability to actively participate in civic life all depend on an individual's ability to read. According to the Department of Justice, "The link between academic failure and delinquency, violence, and crime is welded to reading failure." The stats back up this claim: 8. America's prisons cannot read above a fourth grade level, according to Begin. To. Read. com. Visit the American Library Association to learn more about what libraries are doing - and what you can do - to promote literacy. Your contribution can be as simple as reading stories to young relatives, volunteering to read at your local school or donating your unwanted books to libraries and organizations such as Housing Works. ![]() Resources. Resources. Adult Tutor Resources;. 11 million adults in the United States were non-literate in English and 22 million adults spoke English less than.![]() Backyard Carnival Birthday Ideas
Carnival and Circus Themed Party Ideas. Bring the circus/carnival to your town by throwing your son or daughter a carnival or circus themed birthday party. You can put on the "greatest show on earth" to celebrate your child's big milestone with these fun party ideas and activities for kids. Party Invitations. Send in the guests along with the clowns! Here are some unique ideas for the perfect invitations for your circus or carnival party: Print off the outline of a circus tent on colorful pieces of card stock paper and cut them out. You will need two cutouts per birthday party invitation. On one piece, write all of the party details in the center. On the second piece, carefully cut up the middle from the bottom, stopping about an inch from the top. ![]() ![]() Glue the edges of the two pieces together so the guests can lift the flaps to "open the tent" and view the party information. Inside your invitation, you could put "Come one, come all to the greatest birthday party of all! Join us under the big top to celebrate (your child)'s birthday!"Party Decorations. When decorating for your child's circus or carnival, the first step is to think big—lots of balloons, huge stuffed animals, big signs, and bold colors. Place a large balloon arch made from colorful balloons at the entrance to the party room. Not only does it make a great first impression, but it also can be used later as a backdrop for pictures of everyone. Lions, tigers, and bears—oh my! If you have any humongous stuffed animals (like the ones given out as prizes at the fair), this is the perfect opportunity to pull them out. Hang pieces of butcher paper on the wall and draw (almost) life- sized elephants on them. Party Activities. Want to really bring the circus/carnival to life? Bringing in some live performers is a great way to make your birthday circus or carnival feel just like the real thing. What's the first thing most people think of when they think of the circus? Clowns, of course! Clown entertainers love to come to birthday parties and put on a show. Children and adults alike will laugh at their hilarious antics and comical mishaps. If you want to really "wow" the guests, then animal entertainers are the way to go. · Items available in Kara’s Party Ideas Shop. Carnival Themed Wedding – Kara’s Party Ideas. Other Party Occasions (934) Adult Birthday Parties. Here's one carnival birthday party idea that's definitely. Ideas for Adults Carnival-themed party ideas need not be limited to only kids. A lot carnival games are targeted at kids, with good reason. Adults bring their kids to carnivals so that they can hop on rides, play games and win prizes. Carnivals. Trained animals can perform a wide array of tricks that are guaranteed to dazzle and delight. Depending on what is available in your local area, you could find groups of performing monkeys, birds, dogs, and more. Face painting is a favorite activity for children and would fit in well at a circus birthday party. You can do it yourself or bring in a local party entertainment company to do the face paintings. You can offer everything from small paintings on the cheek to dramatic painted animal masks. Party Games. When visiting a real circus, the audience only gets to sit and watch the amazing spectacular. However, at your child's circus/carnival themed party, everyone can take a starring role in your show! These kids games will let all of your guests take part in your "one day only!" circus. Stick the Nose on the Clown: Everyone loves the classic party game "Pin the Tail on the Donkey". Take this idea and adapt it to your circus party. Every child will get a chance to put the clown's iconic red nose back where it goes. But they must do so while blindfolded and dizzy. The child that puts the nose the closest to the right spot is the winner. The Strongest Man of All: In this game, teams of 3 or 4 kids will race to see who can create the strongest man of all for the circus. You will need an adult sweatshirt and sweatpants for each team, as well as a whole lot of balloons. On go, teams will race to stuff their "strong man's" suit with as many balloons as possible without breaking them. After the designated time is up, count to see which team has used the most balloons. Hungry Elephant: The elephant is hungry and everyone needs to feed him! Make a large elephant out of cardboard with a big, wide open mouth. The kids will take turns tossing peanuts, trying to get them to land in the elephant's mouth. Every time you start a new round, make the children take another step back to make the game more challenging. Party Food and Drinks. No circus/carnival would be complete without a concession stand filled with goodies. Make your own booth filled with these favorite circus/carnival foods: Cut a large cardboard box to create a tray with sides that are only a few inches tall. Decorate the tray, then attach a belt so you can wear it around your neck. Stuff the tray with peanuts and walk around like a circus food vendor shouting "Peanuts! Get your peanuts here!"Everybody loves cotton candy. Plus, it is so much fun to watch it being made fresh in front of you. The machine is easy to use and can be rented from a local party supply rental company. Serve big wads of cotton candy on paper cones and put the leftovers in plastic bags to send home as a party favor. Hot dogs are another good food to serve at a circus party. Kids love them and they are easy to cook on the grill for a large group. Remember to put out toppings like ketchup, mustard, mayo, and relish. Party Cake / Cupcakes. Three round cakes can be used to create your own "three ring circus" cake. If you need a lot of cake to serve your guests, you can place the cakes on top of a large sheet cake. Or you could use cake stands or covered cardboard boxes to display the rings at different heights. On top of one cake, write "Happy Birthday to Ringmaster (Child's Name)!". Top the second cake with lots of plastic animal figurines. On the third cake, cover the top with sprinkles, then use icing to make colorful balloons and clowns. Party Favors and Goody Bags. When it's time to pack away the big carnival tent, send your guests home with a little souvenir bag from their trip to the circus. Tie the bag using the string of a helium balloon for a truly unique presentation. Inside the goody bag, you could stuff: A box of animal crackers. Small plastic circus animals. Foam clown noses. Celebrating their birthday under the big top is something your child will always remember. To them, it will be the "greatest birthday party on earth.". Carnival Theme Party ideas—by a Professional Party Planner. There are certain foods that instantly spring to mind when you think of the Carnival: Caramel Apples, Popcorn, Cotton Candy, Corn Dogs, Churros, Hot Dogs, Funnel Cake, Elephant Ears, Donut Holes, Snow Cones, Salt Water Taffy, Watermelon etc. So, to make things a bit more special I've tried to include a few variations and twists on some of these traditional fairground foods. Instead of serving traditional Caramel Apples, try this variation: an Apple Pie Caramel Apple ( from The Girl Who Ate Everything). Or there are these cute Caramel Apple Cupcakes (below right, from Chockylit's Cupcake Blog). 9/14/2017 0 Comments Asian Lunch Box Ideas For Adults![]() Make lunch a lot more fun with these healthy bento-inspired lunches for kids. Lunch Box Recipes for Kids (or Adults!). Healthy Lunch Ideas. Read More. Yumbox leakproof bento lunch box for kids and adults. Balance & Portion Control Yumbox’s pre- portioned illustrated trays guide you to packing healthy and hassle- free lunches! Now with two smart options: 6- compartment Yumbox encourages variety and healthy eating habits; and 4- compartment Yumbox Panino offers more volume for sandwich/salads, sides and your favorite dip or treat. Leakproof Single Lid Pack applesauce next to crackers with no worries! Yumbox's unique single lid seals all food wells individually. Food won’t touch or leak outside of the box. No baggies! No lost lids! No mess! Think green Reuse, Reduce and Save! Yumbox saves you money by eliminating the need for baggies, multiple containers, plastic wrap and snack packs. Pack a waste free lunch. All food safe materials, BPA- free and phthalates- free. Kid Friendly Yumbox is lightweight and compact with an easy- open latch. It fits neatly into a standard size thermal lunch totes. Yumbox is ideal for toddlers, kids of all ages and adults. Here are 50 packable lunch ideas that. Perfect for kids and adults if you're tired of. ideas, Michelle’s School Lunch series and Lisa’s Smart Lunch box. Find eco-friendly Bento Lunch Boxes and Bento Kits from Bentology, including menus & healthy recipes for portion control, picky eaters and healthy living. Healthy lunch ideas for busy adults. If time is a problem for you consider the following ideas: Pack your lunch the night before and prepare food on the weekend;. · Find easy lunch recipes and ideas from Food Network. Here are bento recipes and lunch box ideas such as teriyaki chicken, tamagoyaki, and apple rabbits that will become your new lunch staples. Pack Yumbox for school, play and work. Educational & Fun Turn your meals into a food adventure for you and your child. Offering a healthy variety of foods will instill good eating habits the fun way! Simple to pack, fun to eat! Pack Yumbox for all of your meals on- the- go. School, travel, play and work. Easy Lunchbox Ideas for the Family. Need some easy lunchbox ideas that LOOK good too? Back to school is in full swing around here. I now have a 1st grader and a preschooler! Wowzers! Needless to say there will be a lot of lunch making going on over here, and I hope to post a round- up like this each Friday ? Hopefully I can help ya’ll with some easy lunchbox ideas for everyone in the family. I try to keep the assembly of each lunch under 1. Although some may look “fancy” it really only takes a couple extra minutes to use a cookie cutter on a sandwich, roll up some lunch meat or skewers some grapes. This was big D’s FAVORITE lunch this week!}Do you love Family Fresh Meals? Never miss out on FUN new meals or easy lunchbox ideas and SIGN UP to have my posts sent right to your inbox! It’s EASY PEASY! Just CLICK HERE and enter your email! XOCorey, Darryl, Big D & Little DHere is what I used to make these Easy Lunchbox Ideas! (Posts may contain affiliate links. If you purchase a product through an affiliate link, your cost will be the same but Family Fresh Meals will automatically receive a small commission. Your support is greatly appreciated.). Lunch Box Ideas (For Adults!)To make this gorgeous salad a meal, include sliced grilled chicken, pork tenderloin, or firm cubed tofu. Bring the DIY dressing (red wine vinegar, olive oil, honey, paprika, and salt) in a separate container. ![]() Krenkede barn kan bli syke voksne. Forsker og allmennlege Anna Luise Kirkengen intervjuet av Eli Gunnvor Grønsdal - Barn som vokser opp i familier preget av. Kåseri (610 stk.) - Skal lære av andres feil Show no mercy! Bokmål - Skyt en elg, skaff deg en klimakvote Du visste kanskje ikke at elgen er en skikkelig. Det er vanlig at voksne tar seg av sine barn når disse settes til verden. I en normal familie er det omsorgspersonene som påtar seg oppgaven å være formynder og. Den iranske revolusjonen i 1979 - en personlig skildring Jeg fikk en oppgave på skolen hvor jeg skulle intervjue noen i familien om en historisk hendelse som de. Frihet til å tenke selv – om improvisjonismens rolle i idrettens lagspill. » Den fotballfaglige æra har vært et langt og kronglete blindspor for norsk fotball. Du bør aldri bruke informasjon fra Internett, inkludert Wikipedia, som eneste kilde til avgjørelser eller tiltak i helsemessige spørsmål. Ved legemiddelspørsmål. Dalsnes Forlag. Frihet til å tenke selv – om improvisjonismens rolle i idrettens lagspill.» Den fotballfaglige æra har vært et langt og kronglete blindspor for norsk fotball. Forståelsen for spillets egenart har de siste tiårene nådd det absolutte lavmål. For aldri før har vel så mange nordmenn trodd at de skuer et lys – som egentlig er et mørke.»» Ingen kan improvisere et annet menneskes handlinger. Når det improviserer er mennesket alene. Det er det selv som skaper – eller for å si det som Laleh sier det i dokumentaren: Jeg går min egen vei – Jag tycker att man ska veta bäst om sin egen kreativitet och sin värklighet. Därför finns det heller ingen anledning att någon annan er sjef over min kreativitet. Jag har rätt att finnas till – rätt att skapa – rätt att ljudsätta livet.»» Mens alle andre samhandlinger – i møte med virkeligheten – stivner, synkner hen, visner og dør, vil den kunstneriske samhandlingen alltid forbli – uforanderlig foranderlig. Därför finns det heller ingen anledning att någon annan er sjef over din kreativitet. Du har rätt att…….»» Fotball, håndball, ishockey, basketball…. Av den grunn kan heller aldri fotballens samhandling bli god – før den lekes frem – av elleve individualister. Og av samme enkle grunn kan heller aldri håndballens samhandling bli god – før den lekes frem – av syv individualister. Og av sam….»» En liten annonse for Fotballkunstneren. Bergens Tidende ved juletider 2. Nordlys i november 2. For Kari og Ola nordmann bør ikke lenger være stumheten selv, i det offentlige samhandlingsrom. Dere må være med å bestemme; hvilken samhandling som samsvarer best med kystbefolkningens intelligens! For det er jo tross alt dere som sitter inne med lokalkunnskapene: Skal våre gutter og jenter gå for den mest avanserte av alle samhandlinger, der spillerne ikke har noe annet valg – enn å tenke samhandlingen selv – eller bør de vernes mot slike ubekvemmeligheter og heller være elleve brikker som før; i trenernes og sportsjournalistenes kritikerroste – ludosamhandlingsspill.»» Selv om det bare er en spiller på laget som orienterer seg etter virkeligheten, så vil han eller hun, så lenge treneren ikke beordrer dem til en avkrok på banen, være et samhandlingslys for sine medspillere. Men dette lys kan bare skinne når kunstneren spiller! Ved skadeavbrekk vil medspillere og supportere igjen lett kunne bli mottagelige, for den fotballfaglige somnambulismen.»» Kjell Magnes verdikommisjon var et sykelig og svakt barn. Bare tre år gammel sovnet det stille og rolig inn. Mer robust og tro på seg selv må vel være de riktige karakteristikker av storebror, som nå nærmer seg pensjonistenes rekker. Men et hardt tanketenkeliv har det uansett vært der ute på samhandlingsøya, omgitt av usikker is på alle sider. Hvor mange tusen grublere som har forsøkt å komme seg i land, og som har måttet snu halvveis med urovekkende bråk under føttene, er umulig å si. Nils Arne Eggen tilbrakte også 2. Bjørn Hansen og Otto Ulseth, utviklet Rosenborgs hemmelige faste samhandling. Og dermed kunne de tre filosofene, som de første i Norge, trampe trygt over til fastlandet. Men mirakelvandringen gikk ikke upåaktet hen. For det finnes vel ingen fotballidiot i dette landet som ikke på et eller annet tidspunkt har deltatt i jakten på de hemmelige trekkene. Men til dags dato, 1. Forklaringen til det magre resultatet kan jo være den; at det kan være vanskelig å finne noe, som ikke finnes. Likevel har dette kollektive åndsstrev fra hel nasjon båret frukter: Den ble Svartedøden for lagspilleres egentenkning i Norge. Men grublere på ei øy er jo ikke et genuint norsk fenomen. De finnes over hele jorden. I Afrika, Asia, Amerika, Europa…. og helt upåvirket av minus femti i Sibir eller femti pluss i Kuwait, så er isen like bristende usikker overalt. Og den vil heller aldri noensinne la seg affisere av et varmere klima eller av iser som smelter på pol. Så Kjetil Bjørnstads ord om lillebror verdikommisjon, gjelder nok også for store bror: I Frankrike ville det ha vært helt utenkelig med en verdikommisjon, for der har de verdikommisjoner rundt ethvert kafébord.»» Otto Ulseth har engang fortalt om et kafébesøk der en ivrig Nils Arne brukte kopper, asjetter, bestikk og saltbøsser som spillere for å forklare hvordan angrepsspillet skulle være. Hvis jeg hadde vært tolv år og hadde sittet ved nabobordet, da ville jeg nok ha reist meg og plantet knyttneven i samhandlingsbordet: Vi fotballspillere skal bestemme trekkene våre selv! I dag er det alt for sent for meg å protestere på det viset. Men det er ikke for sent for dere, som er unge i dag.»» Etter tapet mot Danmark i håndball VM 2. Kristian Kjelling spillere som stikker seg ut og gjør uforutsigbare ting. Men dette er jo en bra karakteristikk av Anja og Pelé! Så det er godt mulig det er deres samhandling Kristian Kjelling søker. Eller skal Kristian Kjelling og hans medspillere, finne opp en ny kunstnerstil? Danmarks landslagstrener Morten Olsen ble for noen år siden spurt om hvorfor ikke laget hans spilte slik Danmark gjorde på åtti og begynnelsen av 1. Jo det skulle jeg gjerne ha likt sa Morten Olsen, men slike spillere finnes ikke lenger i Danmark i dag. Og for noen dager siden var EM 2. For i dag måtte man nok ha samlet spillere fra hele Europa, for å få den samme kreative kraft som det Danmark rådde over, for nærmere tretti år siden.»Det var vel på midten av syttitallet engang, at en fotballfaglig ytret de første ord; om at kunstneren er en egospiller. Og som den middelalderske læren om at jorden var omgitt av stup på alle kanter, resulterte i en nølende utferdstrang hos den tids mennesker, har denne til nå helt uimotsagte fotballfaglige bannbulle, også ledet våre fotballspillere inn i et motløst mørke, når det gjelder det å tenke og handle selv. For selv om autoriteter skifter og århundreder kommer og går, så forblir trusselbildet alltid det samme: Avgrunnen venter dem, som forlater, vårt verdensbildet. Likevel har den faglige eder og galle, som daglig har blitt øst ut over fotballens egospillere, på et merkelig vis, vært den beste næring. For det som engang begynte som et fantasifoster i en fotballfaglig hjerne, har i dag formert seg og blitt til millioner på millioner av ekte egospillere i Europa. Og hvem som er barnets mor og far har vel de fotballfaglige heller aldri forsøkt å skjule. I EMs kvartfinale mellom Tyskland og Italia den 2. Petter Myhre følgende klare beskjed til det norske folk: Det er lett for treneren å flytte brikker på ei tavle, men det er ikke alltid spillerne makter å omsette trenerens teori i praksis. Og selv om det heller aldri har vært enkelt å se skogen for bare trær, så er det nettopp slike utsagn, som leder oss til egospillets kilde. For egospillerne er ingenting annet, enn den fotballfaglige familiens eget tallrike uintelligente avkom. Men det er ikke en brikkeflytter som skal bestemme hvordan forsvaret, midtbanen eller angrepet skal regisseres. Det er det dere spillere selv som skal gjøre. Og det skal dere gjøre – fordi dere er mennesker.» Da Ruud Gullit var trener for Chelsea i 1. Ruud Gullits svar vitner om en klar kunstnerisk fotballforståelse: Nei trekkene, de må jammen spillerne greie å tenke ut selv! Og kunstnerisk frihet var vel også det som kjennetegnet samhandlingen til Nederlands siste store kunstnere: Ruud Gullit, Marco Van Basten, Frank Rijkaard og Dennis Bergkamp. Men i dag subber alle nederlandske fotballspillere rundt i den fotballfaglige samhandlingshengemyren. Verdenskunstnernes og løkkespillernes frie bevegelige taktiske kunnskaper, og den forfinede teknikk som bare kan erverves på ei løkke, finnes ikke lenger, i treskoens hjemland.»» For Pele’ var ethvert øyeblikk ute på banen et rom han ikke tidligere hadde sett, og han hadde øynene med seg, den beste veien videre skulle finnes. Hvor annerledes er ikke den faglige samhandlingen? Blir ikke det som å åpne døren til et rom man kjenner fra før? Man ser ikke, men handler, ut i fra vane.»» Logikken er verdensspråket alle mennesker forstår. Derfor kunne også alle som tenker samhandlingen selv ha vært medspillere til Pele’ og Johan Cruyff på ei løkke. Og verdensstjernene ville generøst ha kommet med bifall og oppmuntrende ord. Men trivselen og den gode stemning ville nok raskt ha blitt en annen om medspillerne hadde blitt byttet ut med Tom Nordli og hans faglige kolleger: Vi vet ikke hvor dere gutter har tankene deres hen, men her er de i hvert fall ikke! For de som tror at logiske handlinger må øves utenat – de sover på en fotballbane.»» Kontrollerer man media, da kontrollerer man også massene. Og som i alle andre ideologier, så er det lydigheten, eller for å være mer presis; massenes stumhet, som også nærer og opprettholder den fotballfaglige autoriteten. Så det skal ikke store dytten til for å velte dette faglige medieskapte palass. Det holder at en verdensstjerne tar til motmæle eller at en fire, fem ungdommer, det være seg i en liten landsby i Iran eller i Nord- Korea, får en ide om å lage et nettsted hvor det oppfordres til sivil ulydighet og en fri samhandling. Og derfra vil egenhelbredelsen fra stumhetens avmakt umiddelbart begynne å bre seg til spillere over hele verden: Aldri mer skal en annen ånd noen gang kontrollere våre tanker.»Frem til slutten av syttitallet kunne også blinde mennesker være «tilskuere» til en fotballkamp. For den gang levde tilskuerne med i spillet og applauderte eller kom med mishagsytringer til hvert eneste spark på ballen: Du må da vel spreng da din toilling…. Hognesauning ved min side, til en ytreløper på Stjørdals- Blink som hadde glemt; at i fotball skal spillerne tenke og handle selv. Men i dag høres bare taktfaste klapp eller det ropes monotone slagord utover landets fotballmatter. Så hvis man tok med et blindt menneske på en fotballkamp i dag, ja da er det vel stor sannsynlighet for at den blinde vil misforstå det hele, og tro at han er, i et galehus. I pausen mellom Frankrike og Nigeria den 3. TV2s Lise Klaveness på sin monitor, hvordan lagene egentlig skulle ha samhandlet. Laws about dating and age difference.. Area of Law. All Areas of Law. Administrative Law. ![]() Admiralty Law. Appeals and Writs. Aviation Law. Banking Law. Bankruptcy Law. Business Law. Civil Rights Law. Computer & Technology Law. Constitutional Law. Construction Law. Is it illegal for a 13 year old girl to date an 18 year old guy? An 18 year old dating a 13 year old? Really - is that legal in Vermont? For a 16 year old to date a 14 year old is not illegal. There are no laws for dating. Is it illegal for a 16 year old girl to date a 14 year old girl? Vermont Dating Laws 13 Dating 16 Year Older
Vermont Dating Laws 13 Dating 16033Consumer Law. Credit, Debt and Collections Law. Criminal Law. Disability Discrimination Law (ADA)Drunk Driving & DUI Law. Education Law. Elder Law. Entertainment & Sport Law. Environmental Law. Family Law, Divorce, Child Custody and Adoption. Family Medical Leave Act. Federal Tort Claims Act Litigation. General Civil Litigation. Health Care Law. Immigration Law. Insurance Law. Intellectual Property. International Law. Investment Law. Juvenile Dependency. Labor and Employment Law. Landlord & Tenants. Legal Ethics & Professional Responsibility. Legal Malpractice Law. Mediation. Medical Malpractice Law. Military Law. Native American Law. Other Discrimination Law (Age, Race, Sex, Gender)Personal Injury Law and Tort Law. Probate, Trusts, Wills & Estates. Products Liability. Real Estate and Real Property. Securities Law. Sexual Harassment Law. Social Security Law. Tax and Taxation Law. Telecommunications Law. Traffic Law. Veterans Law. Workers' Compensation Law. My Son Is Dating a Minor. My Son Is Dating a Minor: Should I Be Worried About the Legal Implications? Your 1. 8- year- old son is dating a 1. A two- year age difference isn’t particularly alarming, and dating is fairly standard at that age. But if these teens are having sex, and you live in a state where prosecutors aggressively enforce the law, it’s possible that your son could be charged with statutory rape. Take, for example, the widely publicized case of Marcus Dwayne Dixon, an 1. She claimed it was rape, he claimed it was consensual, and a jury acquitted him of the charges. However, because of their age difference, the jury still found Dixon guilty of statutory rape and aggravated child molestation, and sentenced him to a mandatory 1. Georgia law. In May 2. Georgia Supreme Court overturned Dixon’s conviction, stating that he should’ve been prosecuted on the lesser charge of misdemeanor statutory rape, which carries a maximum sentence of one year. He walked out of prison on May 3, 2. In an interview after his release, Dixon told The Oprah Show, “Freedom is great. It’s unbelievable that I’m finally home after 1. It’s awesome to be home with my family and friends.”Prior to his court case and conviction, Dixon had been offered a full football scholarship at Vanderbilt University, which was revoked after his arrest. Upon his release from prison, Dixon enrolled at Hampton University in Virginia with a football scholarship. On April 2. 7, 2. Dallas Cowboys. The Dixon case is just one in a long line of similar legal battles teens have faced in the last decade. Whether you agree with this outcome or not, the fact remains that statutory rape is considered a serious crime, enforceable to the full extent of the law in many states – and can change the course of a teenager’s life forever. A Hot Topic Among Teens. The recent discovery that 1. Jamie Lynn Spears, the sister of pop star Britney Spears, became pregnant by her 1. Although there is no public talk of prosecution, and much of the case would depend on where and when the sexual activity took place, onlookers have questioned whether Spears’ boyfriend could be charged with statutory rape, even though the two were in a long- term, consensual relationship. Parents, particularly those with teenage daughters, certainly have cause for concern. Research shows that teenage girls tend to have their first sexual experience with male partners who are three or more years older. In one study, researchers discovered that girls who’d had an older boyfriend by seventh grade were twice as likely to have had sex by ninth grade as girls who’d had a same- age boyfriend by seventh grade. But do these dangers warrant laws that put young people in prison? Romeo and Juliet Make a Comeback. Statutory rape is defined by the FBI as non- forcible sexual intercourse with a person who is younger than the statutory age of consent. The statutory rape laws vary greatly from state to state, with more than half of the states setting the legal age of consent at 1. For the most part, there is no single age at which a person can consent to sexual activity. Only 1. 2 states set a specific age (ranging from 1. The purpose behind most statutory rape laws is to punish grown adults who take sexual advantage of a minor. Because the laws weren’t intended to punish two individuals close in age who engage in consensual sex, in many jurisdictions, an adult who is two or three years older than the minor will not be charged with statutory rape, or will be penalized less severely than a much older adult. These so- called “Romeo and Juliet” laws provide defenses and reduced penalties in cases where the couple is relatively close in age. Depending on the state, Romeo and Juliet laws may reduce the severity of the offense from a felony to a misdemeanor, reduce the penalty to a fine, probation, or community service, and/or eliminate the requirement that the convicted adult register as a sex offender. The following are just a few examples of Romeo and Juliet laws currently in place in the United States: In New Jersey, the age of consent is 1. In the District of Columbia, it is illegal to engage in sexual intercourse with someone who is under the age of 1. According to Louisiana law, it is a misdemeanor for someone aged 1. California law declares it a misdemeanor to have sex with someone younger than 1. Exceptions and Other Considerations In addition to Romeo and Juliet laws, some states have specific exemptions when both parties to the sexual act are minors, or the person to be charged is legally married to the minor. However, there are still restrictions in some states about the type of sexual activity that is permissible, such as oral sex and sodomy, as well as restrictions on relationships involving a minor and a person of authority, including teachers, coaches, or tutors. All states have special provisions if any physical force was used or serious physical injury resulted. Until recently, statutory rape laws applied only to females, ignoring situations involving sex between an adult female and underage male. Today, most laws are gender neutral, and a number of women in authority positions (such as Mary Kay Letourneau, Debra Lafave, Pamela Rogers Turner, and Pamela Smart) have been prosecuted for engaging in sexual relationships with younger males. Does the Punishment Fit the Crime? While many states have strict statutory rape laws on the books, prosecutors have been inconsistent in enforcing them, says Mark Chaffin, a researcher with the National Center on the Sexual Behavior of Youth. In many cases, they are enforced largely by how angry the parents of the younger party are.” In some states, offenders have spent years in prison for statutory rape in situations similar to Jamie Lynn Spears’ while other states have prosecuted only egregious crimes. One particularly shocking case drew international attention when 1. Georgia resident, Genarlow Wilson, was charged with aggravated child molestation and sentenced to 1. Georgia law, which has since been changed to classify this act as a misdemeanor carrying a maximum penalty of one year in prison, also required Wilson to register as a sex offender when he was released. At 2. 1 years of age, Wilson was released from prison when the court declared his sentence “grossly disproportionate to his crime.” Other states have made similar changes in an attempt to undo the harsh effects of exceptionally strict laws. Are Statutory Rape Laws Outdated? Statutory rape laws are based on the premise that although young girls may want to have sex, they may not have enough experience or discernment to make a mature, informed decision. The laws are designed to protect young people who have less information and power than their 1. For example, minors may be less likely than adults to understand sexually transmitted diseases, have access to contraception, and have the resources to raise a child if they become pregnant. Most people believe there is a clear line between young people wanting to date and have sex, and adults molesting or assaulting a child. And most would agree that the difference between intimacy and abuse should be reflected in the laws of each state. But not all parties agree on how strict the laws should be. Critics of strict statutory rape laws argue that while sexual relationships between teens relatively close in age may be morally questionable, prosecuting every case would unnecessarily clog up the justice system. They argue today’s teens often have the social sense to make informed, responsible decisions about sex and don’t need paternalistic laws to “protect their chastity,” and that it’s not the justice system’s responsibility to monitor teen relations. But advocates of more diligent enforcement of statutory rape laws believe that the laws help combat the often underreported and hard- to- prove sexual abuse and rape of young girls. Others add that imprisoning men who are convicted of the crime could have a significant impact on teenage pregnancy and birth rates. Know the Laws in Your State. Dating is a normal part of teenage life. But with the privilege of dating comes serious responsibilities. As a parent, you have to set boundaries and rules and take middle school and high school relationships seriously. If you suspect that your child is sexually involved with someone under the age of 1. Find a Treatment Facility. Start your recovery today by searching for treatment centers below. Or call 8. 77- 6. ![]() Local News. Thursday Feb 23. Wellsboro Man Charged. Wellsboro Police have charged David Williamson. Bradford Dance Academy Stage Classes are for our Students that have reached a Dance Level ready for Performance. The Students are encouraged to be taking Ballet. City Park Dogs Exclusion Order 2011 City Park Dogs on Leads Order 2011 The Dogs Exclusion (City of Bradford Metropolitan District Council) Order 2013 The Dogs on. Check out our extensive list of UK dance studios practicing Ballroom, Latin, Salsa, Tango and other forms of partner dancing. List of UK Dance Studios for Ballroom, Latin, Salsa & Tango. The most comprehensive list of schools, studios and places to dance in UK. Site Navigation | Bradford Council. Adult Social Care. Arts and culture. Benefits. Births, deaths and marriages. Browse all news. Business. Children, young people and families. Compliments and complaints. Consultations. Council Tax. Education and skills. Emergencies. Environment. Environmental health. Health. Housing. Jobs. Bradford On Avon's official tourist information site. Find out What's on in Bradford On Avon and the surrounding area. Find gym membership deals, the cheapest pay-as-you-go gyms (from £10/month) & free passes on Money Saving Expert (incl. Fitness First, LA Fitness, Nuffield. Browse the latest FREE CLASSIFIED ADS in your local area. Thousands of adverts UK including; used cars, properties to rent, pets for sale, free personals and much more! Libraries. Open data. Our websites. Pay. Planning and building control. Recycling and waste. Regeneration. Sport and activities. Transport and roads. Your community. Your Council. Last Mask Center is your top source for learning about Shamanism. Let Shamanic healer, teacher and author Christina Pratt be your guide to Shamanic practice. ![]() Resources – Wildroots. Writing. Books (a few of the must read books in our library)Bowyers Bible- 1- IVIshmael/My Ishmael- Daniel Quinn. Encyclopedia of Edible Plants of North America- Francois Couplan. Flintknapping- John Whittaker. Wigwam- Jess Gottlieb. Buckskin- The Ancient Art of Braintanning- Edholm/Wilder. Native Harvest- Barry Kavasch. Wildfire: Firemaking Art- Russell Cutts. Feasting Free on Wild Edibles- Bradford Angier. Foragers Harvest- Samuel Thayer. Edible Wild Plants- Elias/Dykeman. Botany in a Day- Tom Elpel. Field Guide to Edible Wild Plants- Peterson. Medicinal Plants and Herbs- Peterson. Newcombs Wildflower Guide- Lawrence Newcomb. The Trackers Field Guide- James Lowery. Primitive Technology 1 and 2- David Westcott. The Party’s Over- Richard Heinberg. The Encyclopedia of Country Living- Carla Emory. The Forest People- Colin Turnbull**Bulletin of Primitive Technology- Magazine put out by Society of Primitive Technology. Deerskins into Buckskins- Matt Richards. Mammal Tracks and Sign- Mark Elbroch. Fisherman’s Knots And Nets- Taoul Graumant. Earthknack- Stone Age Tools for the 2. Century- Blankenship. Primitive Living and Survival Skills- John and Geri Mepherson. Wilderness Skills- Applied and Advanced- John and Geri Mc. Pherson. Outdoor Survival Skills- Larry Dean Olsen. Wild Harvest- Alysen Knap. Guide to Wild Foods and Useful Plants- Christopher Nyerges. It Will Live Forever- Beverly Ortiz**Native American Ethnobotany- Daniel Moerman**Edible Forest Gardening 1 and 2- David Jacke. Survival Skills of Native California- Paul Campbell. Indian Fishing- Hilary Stewart. Survival Skills of the North American Indians- Peter Goodchild***1. Charles C. Mann. Links. Our programs focus on re- kindling and applying the practical skills based on ancient knowledge, experiencing the inter- dependency necessary in community living, and nurturing an appreciation for the Earth as a living organism. We do this through intensive hands- on wilderness living skills training, teaching people how to harvest and transform the gifts of nature for everyday needs such as tools, fire, shelter, food…. The skills: Stone flakes and fire kitswild edible and medicinal plantslarge animal processingbow and arrow makinghunting and trapping methodsfishing techniquesrawhidehide tanningclothing and moccasin makingstone and bone toolshorse riding, packing and drivingbasketrypotteryshelters. What we offer: Four Seasons Prehistoric Project is a small school located in North Central Washington. Our goal is to offer high quality instruction in Stone Age living skills to give people the confidence to live in the wilderness simply yet comfortably. We are experienced and passionate about not just teaching the skills but making them a part of our daily life. This school is not our job; it’s our way of life. We live simply, wear buckskin clothing, and eat wild foods, happy to live in a sustainable, respectful manner. We offer small classes limited to 1. We’ve spent a long time thinking about the sequences of skills taught in our classes so that you can experience how the tools you make are used in their appropriate context. For instance, we will teach you how to make stone tools, then let you use them in a variety of tasks throughout the rest of classes so that you can test their effectiveness when used properly. We strongly believe that learning primitive living skills is best done by being immersed in a primitive living setting. Therefore, participants stay at a primitive camp where meals are cooked on an open fire, water is carried from the nearby creek, and people tell stories or play music around the campfire as entertainment. Moreover, we give you time to get acquainted to new tools and materials, letting you gain experience and comfort with things that maybe unfamiliar. THE TRIBE IS GATHERING…. The Living Wild School has operated largely on a donation basis and has been hosted by many appreciated land- owners, trading work on the property or sometimes paying rent. Most of my students go on to teach these valuable and disappearing skills themselves, many of them coming back to experience the “Projects” year after year. We have a permanent base in the Twisp River drainage on the beautiful eastern slopes of the North Cascades in Okanogan county, Washington. So come Live Wild and help make the world a better place. BOSS, the Boulder Outdoor Survival School, is the oldest and largest traditional living skills / survival school in the world. Since 1. 96. 8, we have offered adventurous souls the chance to learn indigenous skills in an active, hands- on environment. Courses range from 3- 2. Southern Utah. There was a time just a few generations ago when things were simpler. Food was grown locally. Resources were managed. People understood the cycle of things. Today, our hyper- technological societies have produced a world in which respect for the earth and resource management are often afterthoughts. We may have gained a sense of power and control but in the process we’ve lost a sacred connection with the natural world. We’ve forgotten that everything is interconnected and living without this awareness is, we believe, both unhealthy and unsustainable. At BOSS, we believe there is value in the “Old Ways” of walking lightly through the wilderness and we believe that it is accessible to everyone. Our courses hope to reconnect you with it. The skills we teach at BOSS come from native cultures around the world, cultures that sought harmony with their environment to preserve a sacred wisdom. As a result, BOSS students experience a closeness with the land, its resources and its inhabitants that teaches sustainability and respect. There is power, beauty and balance in the ancient paths we preserve, and we sincerely invite you to join us on the trail. We hope you’ll come to reconnect –– both with nature and with yourself. WHY ARE YOU HERE…. I am a one man operation, using almost no electricity, Oscar Wildeworking from my home on the Flathead reservation in Western Montana, this is what I do. The only thing I don’t do is kill every deer who’s skin I use but short of that I am intimately involved with each and every skin. Every skin you receive from me will have been worked from start to finish by me with hand tools, year round, generally outside in, I’ve even gathered all the punky wood for smoking and make a real fire to smoke the skins. I do use nylon to sew holes but I will use sinew stripped and processed by myself if you want it. My customers include many First Nations Peoples across the United States including whole individual Sovereign First Nations Tribes. My work is sought by those who don’t want farmed out, factory processed or otherwise soulless work, but instead understand the value of buckskin and its important links with the past and the future. Customer uses for buckskin skins: Ceremonial Garments (Marriage, Burial, Births, Special Occasions), Pipe and Ceremonial Bags, Drum Heads for Native American Church Drums, Meditation Mats, Bead workers Delight!, Cradle Boards, Silent Hunting Clothing, Museum Pieces, and Re- Enactment Participants (Mountain Man). If you don’t care about what goes into the creation of the buckskin you plan to use then don’t order from me. If you do care, I can’t wait to talk to you. Earth Knack Stone Age Skills for the 2. Century. Primitive and Modern Life Skills Training. Don’t just survive…Thrive! Earth Knack has been offering primitive skills courses, wilderness treks, and sustainable modern life skills teaching since 1. The Earth Knack school site is near Crestone, Colorado and the Great National Sand Dunes. Robin Blankenship owns and operates Earth Knack and has been working in the outdoor field since 1. Earthwalk Northwest offers programs focusing on earth awareness and primitive living skills, including primitive bow making, fire by friction, wild edibles, and much more. Our unique courses provide in- depth, hands- on experience, allowing participants to deepen their understanding of traditional skills while learning how to wisely use and honor the many gifts the earth has to offer. The Society of Primitive Technology is a non- profit organization dedicated to the research, practice, and teaching of primitive technology. The purpose of the Society of Primitive Technology is: to promote the practice and teaching of aboriginal skills; to foster communication between teachers and practitioners; to set standards for authenticity, ethics and quality. The Bulletin is to serve as a means of accomplishing these goals. Traditional Tanners. Tools and instruction on the natural way of making buckskin. Publishes an incredible How- To book called Deerskins Into Buckskins by Matt Richards. A really good schedule of gatherings where braintanning is taught. Vermont Wilderness School is a community non- profit organization that offers powerful nature- based mentoring programs for children and adults. Our programs are based in the Connecticut River Valley bioregion of southern Vermont and western Massachusetts. Through our annual Art of Mentoring workshop and other regional programs, we also help to grow nature- based education and community development throughout the Northeast. Our work has touched the lives of thousands of children and adults since 2. We envision a future of vibrant communities inhabiting their bioregions sustainably for the long term. Our mentoring approach builds deep relationships with the natural world, preparing our students to be passionate caretakers of the planet. Our work is rooted in a deep topsoil of teachings and practices, initially gathered by Jon Young and Wilderness Awareness School and further refined by hundreds of organizations around the world. This bundle is based in traditional mentoring practices used by indigenous cultures from around the world. The wisdom of these practices is affirmed by current research in brain development, inquiry- based learning and human development – as well as by the experiences of our global network over the past 3. |
AuthorWrite something about yourself. No need to be fancy, just an overview. ArchivesCategories |